>>11348482FUCKING CAMERA PICTURES OF SCREENS! WHAT THE FUCK! Get that shit outta here. Second it's not too surprising that the chinese military would investigate SARS-like diseases, because that could make their own soldiers sick, making them less effective in combat. China developed artemisinin so that the Viet Cong would have a lower mortality rate from malaria, increasing their combat effectiveness.
https://en.wikipedia.org/wiki/Project_523>>11348523Could be conserved. And fuck the entire protein is
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
that seems tiny, but I ain't no biologist. There might not be much shit that can change, cause the virus has to fit into some cell receptor. And as far as the it shouldn't be 100% identical stuff goes, yeah, there was some variation in envelope proteins all over the world, but what about in the same part of the world or even within the same population of bats?
>>11348530now that's better, some actual fucking links instead of PICTURES OF A SCREEN! Now that the sequence is out, it should be possible to look for evidence of genetic modification using CRISPR-Cas9 or other genetic modification techniques. And if it really was engineered, you can bet your ass people are gonna find out and china's gonna suffer for it. Now I think I might have shilled too much for china. While there's not good evidence the chinese engineered this virus, there is definitive evidence for china's Uighur concentration camps. There is also good evidence that china harvests organs from political prisoners:
https://www.theguardian.com/world/2019/nov/15/chinese-government-may-have-falsified-organ-donation-numbers-study-saysAlso winnie the pooh.
